FileMood

Showing results 94 to 113 of about 467 for dynamodb

Amazon Web Services in Action, Third Edition, Video Edition

2.0 GB

/079. Chapter 12. Programming for the NoSQL database service DynamoDB.mp4

23.2 MB

/087. Chapter 12. DynamoDB Local.mp4

2.7 MB

/088. Chapter 12. Operating DynamoDB.mp4

5.9 MB

/091. Chapter 12. Comparing DynamoDB to RDS.mp4

6.8 MB

 

Showing first 4 matched files of 120 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/3. Domain 2 Storage/12. DynamoDB Overview.mp4

36.7 MB

/3. Domain 2 Storage/12. DynamoDB Overview.srt

11.0 KB

/3. Domain 2 Storage/13. DynamoDB RCU & WCU.mp4

55.8 MB

/3. Domain 2 Storage/13. DynamoDB RCU & WCU.srt

14.9 KB

/3. Domain 2 Storage/14. DynamoDB Partitions.mp4

19.9 MB

 

Showing first 5 matched files of 612 total files

[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/020 DynamoDB - Review Part I.mkv

68.1 MB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/021 DynamoDB - Review Part II.mkv

109.9 MB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/022 DynamoDB - Patterns.mkv

6.2 MB

 

Showing first 3 matched files of 242 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/020 DynamoDB - Review Part I.mkv

68.1 MB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/021 DynamoDB - Review Part II.mkv

109.9 MB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/022 DynamoDB - Patterns.mkv

6.2 MB

 

Showing first 3 matched files of 234 total files

Ignite 4.0 - Rocketseat

76.9 GB

/Node/Chapter VI/02 - Serverless/01 - Serverless/05 - Conhecendo o DynamoDB - Rocketseat[3].mp4

43.3 MB

/Node/Chapter VI/02 - Serverless/01 - Serverless/06 - Configurando o DynamoDB - Rocketseat[3].mp4

157.8 MB

 

Showing first 2 matched files of 638 total files

desire-course.-net-udemy-aws-certified-solutions-architect-associate-2020_202009

9.6 GB

/5. Databases On AWS/5. DynamoDB.mp4

41.0 MB

/5. Databases On AWS/5. DynamoDB.srt

6.3 KB

/5. Databases On AWS/6. Advanced DynamoDB [SAA-C02].mp4

66.7 MB

/5. Databases On AWS/6. Advanced DynamoDB [SAA-C02].srt

23.0 KB

 

Showing first 4 matched files of 696 total files

AWS Certified Cloud Practitioner - Complete NEW Course 2021

6.1 GB

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/11. Databases and Analytics/7. [HOL] Create Amazon DynamoDB Table-fr_FR.srt

8.0 KB

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/11. Databases and Analytics/7. [HOL] Create Amazon DynamoDB Table-de_DE.srt

7.9 KB

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/11. Databases and Analytics/7. [HOL] Create Amazon DynamoDB Table-id_ID.srt

7.6 KB

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/11. Databases and Analytics/7. [HOL] Create Amazon DynamoDB Table-es_ES.srt

7.4 KB

/[TutsNode.com] - AWS Certified Cloud Practitioner - Complete NEW Course 2021/11. Databases and Analytics/7. [HOL] Create Amazon DynamoDB Table-it_IT.srt

7.4 KB

 

Showing first 5 matched files of 1644 total files

UD1

5.3 GB

/03 Domain 2 Storage/036 DynamoDB Overview.mp4

36.7 MB

/03 Domain 2 Storage/037 DynamoDB RCU WCU.mp4

55.8 MB

/03 Domain 2 Storage/038 DynamoDB Partitions.mp4

19.9 MB

/03 Domain 2 Storage/039 DynamoDB APIs.mp4

46.2 MB

/03 Domain 2 Storage/040 DynamoDB Indexes LSI GSI.mp4

27.4 MB

 

Showing first 5 matched files of 138 total files

20 Programming Books Collection PDF Pack 3

0/1

266.6 MB

/Books/Alex DeBrie The DynamoDB BookGumroad 2020.pdf

21.9 MB

/Covers/Alex DeBrie The DynamoDB BookGumroad 2020.jpg

162.0 KB

 

Showing first 2 matched files of 40 total files

Pragmatic System Design

0/1

569.0 MB

/[TutsNode.com] - Pragmatic System Design/9. Design a URL Shortener (aka TinyURL)/4. DynamoDB.srt

1.3 KB

/[TutsNode.com] - Pragmatic System Design/9. Design a URL Shortener (aka TinyURL)/4. DynamoDB.mp4

2.2 MB

 

Showing first 2 matched files of 182 total files

[FreeCourseSite.com] Udemy - AWS Certified Solutions Architect - Associate [Latest Exam]

25.4 GB

/27. Amazon Serverless Services/20. AWS DynamoDB - Review of NoSQL and Data Types.mp4

20.2 MB

/27. Amazon Serverless Services/20. AWS DynamoDB - Review of NoSQL and Data Types.srt

11.3 KB

/27. Amazon Serverless Services/21. DynamoDB Introduction.mp4

32.4 MB

/27. Amazon Serverless Services/21. DynamoDB Introduction.srt

19.7 KB

/27. Amazon Serverless Services/22. DynamoDB tables, components, Primary Key.mp4

19.7 MB

 

Showing first 5 matched files of 1023 total files

UD151

11.5 GB

/10 Serverless/165 Create function to log event when records updated in DynamoDB.mp4

77.9 MB

/11 Databases/183 Amazon DynamoDB Overview.mp4

41.8 MB

/11 Databases/184 Create Amazon DynamoDB Table.mp4

36.7 MB

/11 Databases/185 Create Amazon DynamoDB DAX Cluster and Test Cache.mp4

120.3 MB

/11 Databases/186 Create Amazon DynamoDB Global Table.mp4

25.5 MB

 

Showing first 5 matched files of 275 total files

[ DevCourseWeb.com ] Udemy - AWS DynamoDb, S3, SNS, SQS ,Beanstalk with Java.zip

1.7 GB

[OTUS] AWS для разработчиков (Часть 1-3) (2020)

5.5 GB

/14 RDS, DynamoDB, Neptune/cloud_lec_RDS.pptx

413.4 KB

/14 RDS, DynamoDB, Neptune/zoom.mp4

134.3 MB

 

Showing first 2 matched files of 58 total files

PluralSight.Developing..NET.Core.Applications.with.DynamoDB.on.AWS.Bookware-KNiSO

340.4 MB

/kniso-developing..net.core.applications.with.dynamodb.on.aws.nfo

2.0 KB

/kniso-developing..net.core.applications.with.dynamodb.on.aws.r00

15.0 MB

/kniso-developing..net.core.applications.with.dynamodb.on.aws.r01

15.0 MB

/kniso-developing..net.core.applications.with.dynamodb.on.aws.r02

15.0 MB

/kniso-developing..net.core.applications.with.dynamodb.on.aws.r03

15.0 MB

 

Showing first 5 matched files of 25 total files

Pluralsight - Amazon DynamoDB Best Practices by Rajdeep Saha

414.2 MB

/1. Designing Databases with DynamoDB/0. Course Introduction.mp4

3.1 MB

/1. Designing Databases with DynamoDB/0. Course Introduction.srt

2.9 KB

/1. Designing Databases with DynamoDB/1. Intro to DynamoDB.mp4

10.2 MB

/1. Designing Databases with DynamoDB/1. Intro to DynamoDB.srt

7.7 KB

/1. Designing Databases with DynamoDB/2. DynamoDB Use Cases.mp4

12.1 MB

 

Showing first 5 matched files of 74 total files

UD31

7.2 GB

/03 Understanding Core AWS Services/040 Getting Started with DynamoDB.mp4

158.1 MB

 

Showing first 1 matched files of 91 total files

UD610

3.6 GB

/aws-certified-cloud-practitioner-new/09 Databases Analytics/086 DynamoDB Overview.mp4

7.9 MB

/aws-certified-cloud-practitioner-new/09 Databases Analytics/087 DynamoDB Hands On.mp4

12.0 MB

/aws-certified-cloud-practitioner-new/15 VPC Networking/141 VPC Endpoints - Interface Gateway (S3 DynamoDB).mp4

14.4 MB

 

Showing first 3 matched files of 196 total files

[FTUForum.com] [UDEMY] COMPLETE- AWS Developer Certification [FTU]

3.2 GB

/7. Project-2 Lambda function with DynamoDB/1. Writing data to DynamoDB.mp4

42.3 MB

/7. Project-2 Lambda function with DynamoDB/1. Writing data to DynamoDB.vtt

2.4 KB

/7. Project-2 Lambda function with DynamoDB/2. Reading data from DynamoDB.mp4

26.6 MB

/7. Project-2 Lambda function with DynamoDB/2. Reading data from DynamoDB.vtt

2.0 KB

/8. Cloud Database/6. DynamoDB.mp4

41.8 MB

 

Showing first 5 matched files of 145 total files

UD489

9.1 GB

/04 Data Storage - Part 2/072 DynamoDB.mp4

19.3 MB

/04 Data Storage - Part 2/073 Lab 3.3 - DynamoDB.mp4

35.5 MB

/04 Data Storage - Part 2/074 DynamoDB Design Considerations.mp4

54.8 MB

/04 Data Storage - Part 2/075 Lab 3.4 - DynamoDB Throughput consumption.mp4

18.6 MB

/06 AWS Services - Part 2/115 Lab 5.7 - API gateway Lambda and DynamoDB.mp4

69.7 MB

 

Showing first 5 matched files of 157 total files


Copyright © 2025 FileMood.com