|
Macrorit Partition Expert 6.0.7 Unlimited Edition RePack (& Portable) by elchupacabra |
|
9.8 MB |
|
|
|
9.8 MB |
|
Showing first 1 matched files of 3 total files |
|
|
|
15.6 MB |
||
|
|
15.6 MB |
|
Showing first 1 matched files of 3 total files |
|
|
EaseUS Partition Master (All Editions) v18 0 Build 20230912 (Lifetime Activation) Safe.zip |
|
34.9 MB |
|
|
|
12.0 MB |
||
|
|
12.0 MB |
|
Showing first 1 matched files of 2 total files |
|
|
|
17.2 MB |
||
|
|
4.3 MB |
||
|
/Macrorit Partition Expert 8.0.0 + Keygen/Setup/mde-serv-setup.exe |
4.0 MB |
|
|
0.1 KB |
|
|
0.7 KB |
|
|
270.7 KB |
|
/Macrorit Partition Expert 8.0.0 + Keygen/Setup/mde-serv-setup.ico |
25.2 KB |
|
Showing first 5 matched files of 8 total files |
|
|
MiniTool Partition Wizard Professional Edition 16.5.1 + Crack |
|
15.8 MB |
|
|
/MiniTool Partition Wizard Professional Edition 16.5.1 + Crack.exe |
15.8 MB |
|
Showing first 1 matched files of 3 total files |
|
|
|
50.5 MB |
||
|
|
12.3 MB |
||
|
/Macrorit Partition Expert 8.0.0 + Keygen/Setup/mde-serv-setup.exe |
12.1 MB |
|
|
0.1 KB |
|
|
0.7 KB |
|
|
270.7 KB |
|
Showing first 4 matched files of 7 total files |
|
|
|
14.1 MB |
||
|
EaseUS Partition Master 7.7.7.7 Multilingual Portable Pre-Activated Fully Activated Marvel.zip |
|
29.1 MB |
|
|
Adobe Substance 3D Sampler v4.1.2.3298 (x64) + Fix {CracksHash} |
|
1.9 GB |
|
|
|
0.9 KB |
|
/Setup/products/SBSTA/Substance3DSampler1-core/1/Adobe Substance 3D Sampler/include/igl/partition.h |
0.7 KB |
|
Showing first 2 matched files of 4936 total files |
|
|
PowerQuest_PartitionMagic_v5.01_Multilingual_MSDOS_Win95_WinNT_Win2000_2000_Eng |
|
303.0 MB |
|
|
|
524.9 KB |
|
/1_PowerQuest-PartitionMagic-v501-Multilingual - Cover_thumb.jpg |
6.4 KB |
|
|
388.0 KB |
|
|
6.3 KB |
|
/PowerQuest-PartitionMagic-v501-Multilingual - Serial Number.jpg |
267.6 KB |
|
Showing first 5 matched files of 10 total files |
|
|
Quad-Boot-DOS-w31-W95-W98-ME-1-Disk-Manual-Install-No-Boot-Manager-VHD |
|
439.4 MB |
|
|
|
242.9 KB |
|
|
8.8 KB |
|
Showing first 2 matched files of 14 total files |
|
|
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
|
|
19.9 MB |
|
|
4.7 KB |
|
/4. Domain 3 Processing/8. What is Glue + Partitioning your Data Lake.mp4 |
31.3 MB |
|
/4. Domain 3 Processing/8. What is Glue + Partitioning your Data Lake.srt |
8.1 KB |
|
Showing first 4 matched files of 612 total files |
|
|
AOMEI Partition Assistant Technician v10.1.0 Multilingual Activated.rar |
|
40.5 MB |
|
|
|
14.1 MB |
||
|
AOMEI Partition Assistant Technician Edition 10.1.0 RePack (& Portable) by elchupacabra |
|
42.5 MB |
|
|
|
42.5 MB |
|
Showing first 1 matched files of 3 total files |
|
|
PassFab 4EasyPartition v2.2.1.3 Multilingual Clean Crack.zip |
|
40.7 MB |
|
|
|
99.8 MB |
||
Copyright © 2025 FileMood.com
