|
12/0 |
7.9 GB |
||
|
/3/SIMULIA_EstablishedProducts/Windows64/2/CAFS/CODE/win_b64/SMAVenHighCharts.zip |
10.6 MB |
|
Showing first 1 matched files of 2360 total files |
|
|
2/1 |
426.6 MB |
||
|
|
7.6 MB |
|
Showing first 1 matched files of 24 total files |
|
|
0/3 |
241.4 MB |
||
|
/Covers/Beginning javascript Charts With jqPlot, d3, and Highcharts.jpg |
30.6 KB |
|
/Beginning javascript Charts With jqPlot, d3, and Highcharts.pdf |
20.2 MB |
|
Showing first 2 matched files of 40 total files |
|
|
1/1 |
4.2 GB |
||
|
|
0.1 KB |
|
|
15.0 KB |
|
|
141.5 MB |
|
|
0.1 KB |
|
|
0.1 KB |
|
Showing first 5 matched files of 238 total files |
|
|
[ DevCourseWeb.com ] Udemy - React Data Visualization - Build a Cryptocurrency Dashboard |
0/2 |
2.4 GB |
|
|
/~Get Your Files Here !/01 - Introduction and Setup/cryptodash/src/Dashboard/HighchartsConfig.js |
0.7 KB |
|
/~Get Your Files Here !/01 - Introduction and Setup/cryptodash/src/Dashboard/HighchartsTheme.js |
4.7 KB |
|
|
54.1 MB |
|
/~Get Your Files Here !/08 - Dashboard/006 HighCharts_en.vtt |
5.4 KB |
|
/~Get Your Files Here !/08 - Dashboard/007 HighCharts Theme Link (Updated).html |
0.4 KB |
|
Showing first 5 matched files of 113 total files |
|
|
The Ultimate IT Ebooks Collection - 1800+ IT and Computer Science Ebooks |
0/2 |
28.6 GB |
|
|
|
9.0 MB |
|
Showing first 1 matched files of 1809 total files |
|
|
|
52.6 GB |
||
|
|
444.4 KB |
|
|
140.9 KB |
|
|
100.7 KB |
|
|
60.2 KB |
|
|
57.9 KB |
|
Showing first 5 matched files of 1825 total files |
|
|
|
4.9 GB |
||
|
|
5.1 GB |
||
|
|
1.2 GB |
||
|
|
377.1 KB |
|
Showing first 1 matched files of 740 total files |
|
|
|
20.2 MB |
||
|
|
8.0 MB |
||
|
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
|
/7. Domain 5 Visualization/7. Other Visualization Tools (HighCharts, D3, etc).mp4 |
19.8 MB |
|
/7. Domain 5 Visualization/7. Other Visualization Tools (HighCharts, D3, etc).srt |
4.5 KB |
|
Showing first 2 matched files of 612 total files |
|
|
|
5.3 GB |
||
|
/06 Domain 5 Visualization/111 Other Visualization Tools (HighCharts D3 etc).mp4 |
19.8 MB |
|
Showing first 1 matched files of 138 total files |
|
|
|
433.6 MB |
||
|
|
3.4 MB |
|
Showing first 1 matched files of 79 total files |
|
|
|
1.9 GB |
||
|
|
92.0 MB |
|
|
47.3 MB |
|
|
368.4 KB |
|
|
19.0 MB |
|
|
31.7 MB |
|
Showing first 5 matched files of 105 total files |
|
|
|
36.7 MB |
||
|
|
21.2 MB |
|
|
15.6 MB |
|
2 matched files |
|
|
|
5.4 GB |
||
|
/06 Domain 5 Visualization/106 Other Visualization Tools (HighCharts D3 etc).mp4 |
19.8 MB |
|
Showing first 1 matched files of 141 total files |
|
|
|
5.3 GB |
||
|
/06 Domain 5 Visualization/111 Other Visualization Tools (HighCharts D3 etc).mp4 |
19.8 MB |
|
Showing first 1 matched files of 137 total files |
|
|
|
3.2 GB |
||
|
|
11.8 MB |
|
Showing first 1 matched files of 122 total files |
|
Copyright © 2025 FileMood.com