|
[FreeCourseWorld.Com] Udemy - AWS Certified Big Data Specialty 2020 - In Depth & Hands On! |
1/2 |
5.4 GB |
|
|
/04 Domain 3 Processing/069 S3DistCP and Other Services.en.srt |
8.1 KB |
|
|
38.7 MB |
|
Showing first 2 matched files of 270 total files |
|
|
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
|
|
38.7 MB |
|
|
8.4 KB |
|
Showing first 2 matched files of 612 total files |
|
|
|
5.3 GB |
||
|
|
38.7 MB |
|
Showing first 1 matched files of 138 total files |
|
|
|
5.4 GB |
||
|
|
38.7 MB |
|
Showing first 1 matched files of 141 total files |
|
|
|
5.3 GB |
||
|
|
38.7 MB |
|
Showing first 1 matched files of 137 total files |
|
|
|
3.2 GB |
||
|
|
24.4 MB |
|
Showing first 1 matched files of 122 total files |
|
|
|
3.2 GB |
||
|
|
24.4 MB |
|
Showing first 1 matched files of 122 total files |
|
|
AWS Certified Big Data Specialty 2019 - In Depth & Hands On!- [UdemyCourseDownloader] |
|
5.1 GB |
|
|
/04. Domain 3 Processing/23. S3DistCP and Other Services.mp4 |
38.7 MB |
|
/04. Domain 3 Processing/23. S3DistCP and Other Services.vtt |
7.4 KB |
|
Showing first 2 matched files of 274 total files |
|
Copyright © 2024 FileMood.com