Desirecourse netudemyawscertifieddataanalyticsspecialty2020exbigdata |
||
Domain Storage 19 DynamoDB TTL srt |
Name |
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
DOWNLOAD
Copy Link
Trouble downloading? see How To |
Total Size |
6.7 GB |
|
Total Files |
612 |
|
Hash |
07E7A0665C6F5E503F6139889A05E32D09876CD0 |
|
6.3 KB |
|
26.8 MB |
|
4.8 KB |
|
14.6 KB |
|
18.6 MB |
|
46.2 MB |
|
4.4 KB |
|
11.0 KB |
|
14.9 KB |
|
1.8 KB |
|
4.7 KB |
|
16.0 MB |
|
36.7 MB |
|
14.0 KB |
|
55.8 MB |
Showing first 15 files of 612 total files |
Copyright © 2025 FileMood.com