Desirecourse netudemyawscertifieddataanalyticsspecialty2020exbigdata |
||
Domain Processing Lambda Integration Part mp4 |
Name |
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
DOWNLOAD
Copy Link
Trouble downloading? see How To |
Total Size |
6.7 GB |
|
Total Files |
612 |
|
Hash |
07E7A0665C6F5E503F6139889A05E32D09876CD0 |
|
35.3 MB |
|
44.9 MB |
|
10.6 KB |
|
9.7 KB |
/4. Domain 3 Processing/14. EMR, AWS integration, and Storage.mp4 |
53.7 MB |
/4. Domain 3 Processing/1. Section Introduction Processing.mp4 |
32.2 MB |
/4. Domain 3 Processing/14. EMR, AWS integration, and Storage.srt |
53.7 MB |
|
11.6 MB |
|
29.8 MB |
|
23.6 MB |
|
28.6 MB |
|
54.7 MB |
|
19.6 MB |
|
26.1 MB |
|
47.6 MB |
Showing first 15 files of 612 total files |
Copyright © 2025 FileMood.com