|
62.6 MB |
||
|
230.9 KB |
|
1.5 MB |
|
52.2 KB |
Showing first 3 matched files of 284 total files |
|
100.7 GB |
||
|
282.6 KB |
|
0.1 KB |
Showing first 2 matched files of 739 total files |
|
65.2 GB |
||
/Shmoocon2023-Kaitlyn_DeValk-Riverside-A_Network_Security_Visualization_Tool.mp4 |
598.6 MB |
Showing first 1 matched files of 102 total files |
[GigaCourse.Com] Udemy - 10 Days of No Code Artificial Intelligence Bootcamp |
|
7.1 GB |
|
|
68.0 MB |
|
9.6 KB |
|
100.8 MB |
|
14.2 KB |
|
106.2 MB |
Showing first 5 matched files of 239 total files |
|
108.7 GB |
||
|
282.6 KB |
|
0.1 KB |
Showing first 2 matched files of 724 total files |
|
1.5 GB |
||
/~Get Your Files Here !/06 Visualizations/001 Overview of the Power BI Report View.en.srt |
20.2 KB |
/~Get Your Files Here !/06 Visualizations/001 Overview of the Power BI Report View.mp4 |
185.7 MB |
/~Get Your Files Here !/06 Visualizations/002 Troubleshooting.en.srt |
16.0 KB |
/~Get Your Files Here !/06 Visualizations/002 Troubleshooting.mp4 |
178.4 MB |
/~Get Your Files Here !/06 Visualizations/003 Measures.en.srt |
10.2 KB |
Showing first 5 matched files of 51 total files |
[ TutGator.com ] Linkedin - Managing Data with Microsoft 365 |
|
173.3 MB |
|
|
176.5 KB |
Showing first 1 matched files of 53 total files |
[CourseClub.Me] SkillShare - Data Science and Business Analytics with Python |
|
3.3 GB |
|
|
201.1 MB |
|
8.3 KB |
|
64.6 MB |
|
7.0 KB |
Showing first 4 matched files of 76 total files |
[CourseClub.Me] Coursera - Object Oriented Java Programming Data Structures and Beyond |
|
4.7 GB |
|
|
14.9 KB |
|
9.6 KB |
|
22.3 MB |
Showing first 3 matched files of 766 total files |
VA - Electronic Saviors Industrial Music To Cure Cancer 1-3 (2010-2014) |
|
3.5 GB |
|
|
9.5 MB |
Showing first 1 matched files of 325 total files |
[FreeCourseSite.com] Udemy - Python Bootcamp for Data Science 2021 Numpy Pandas & Seaborn |
|
2.1 GB |
|
|
66.7 MB |
||
/uTorrentPortable/App/uTorrent/player/plugins/visualization/libgoom_plugin.dll |
230.9 KB |
/uTorrentPortable/App/uTorrent/player/plugins/visualization/libprojectm_plugin.dll |
1.5 MB |
/uTorrentPortable/App/uTorrent/player/plugins/visualization/libvisual_plugin.dll |
52.2 KB |
Showing first 3 matched files of 298 total files |
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
/7. Domain 5 Visualization/1. Section Introduction Visualization.mp4 |
20.3 MB |
/7. Domain 5 Visualization/1. Section Introduction Visualization.srt |
1.4 KB |
/7. Domain 5 Visualization/2. Intro to Amazon Quicksight.mp4 |
64.0 MB |
/7. Domain 5 Visualization/2. Intro to Amazon Quicksight.srt |
11.5 KB |
/7. Domain 5 Visualization/3. Quicksight Pricing and Dashboards; ML Insights.mp4 |
30.3 MB |
Showing first 5 matched files of 612 total files |
|
97.0 GB |
||
|
282.6 KB |
|
0.1 KB |
Showing first 2 matched files of 693 total files |
|
547.7 MB |
||
|
59.6 MB |
||
/Wattenberger A. Fullstack D3 and Data Visualization...2021.pdf |
59.6 MB |
1 matched files |
|
103.6 GB |
||
|
282.6 KB |
|
0.1 KB |
Showing first 2 matched files of 739 total files |
|
87.5 GB |
||
/AlanWake2/data/shaders/build/pc_dx12/fillvisualization.binrfx |
18.8 KB |
Showing first 1 matched files of 253 total files |
[ TutGator.com ] Udemy - The Data Visualization Course - Excel, Tableau, Python, R |
|
3.7 GB |
|
/~Get Your Files Here !/1 - Introduction/2 - Why Learn Data Visualization.mp4 |
44.8 MB |
/~Get Your Files Here !/1 - Introduction/2 - Why Learn Data Visualization_en.srt |
8.5 KB |
|
36.3 MB |
|
9.6 KB |
|
8.7 KB |
Showing first 5 matched files of 229 total files |
|
87.8 GB |
||
/AlanWake2/data/shaders/build/pc_dx12/fillvisualization.binrfx |
18.8 KB |
Showing first 1 matched files of 259 total files |
Copyright © 2025 FileMood.com