|
377.2 MB |
||
|
1.5 MB |
|
109.7 KB |
Showing first 2 matched files of 80 total files |
[FreeCourseSite.com] Udemy - The Ultimate Hands-On Hadoop Tame your Big Data! |
|
3.3 GB |
|
|
191.3 MB |
|
33.9 KB |
|
31.8 MB |
|
13.1 KB |
|
92.8 MB |
Showing first 5 matched files of 203 total files |
[ FreeCourseWeb.com ] Cloudera Hadoop Big Data Authentication With Kerberos.zip |
|
671.9 MB |
|
[FreeCoursesOnline.Me] PacktPub - Big Data for Architects [Video] |
|
5.3 GB |
|
/05.02-hadoop_distributed_file_system_(hdfs)_versus_hbase.mkv |
70.5 MB |
/05.04-hadoop_distributed_file_system_(hdfs)_versus_kudu.mkv |
45.5 MB |
Showing first 2 matched files of 68 total files |
|
1.2 GB |
||
|
5.8 MB |
|
65.1 KB |
Showing first 2 matched files of 120 total files |
|
11.8 GB |
||
Analytics Visualização Relatórios e Tomada de Decisões com Big Data |
|
7.2 GB |
|
/06 Big Data Analytics com Aure HDInsight - Parte 1/03 Por que utilizar Hadoop na Nuvem.mp4 |
15.6 MB |
/06 Big Data Analytics com Aure HDInsight - Parte 1/02 Hadoop.mp4 |
30.2 MB |
Showing first 2 matched files of 388 total files |
|
1.0 GB |
||
/Books/Karambelkar Scaling Big Data With Hadoop And Solr 2013.pdf |
2.5 MB |
/Covers/Karambelkar Scaling Big Data With Hadoop And Solr 2013.jpg |
735.2 KB |
Showing first 2 matched files of 80 total files |
|
382.6 MB |
||
/Books/Hadoop MapReduce Cookbook - Srinath Perera, Thilina Gunarat.epub |
5.2 MB |
|
62.5 KB |
Showing first 2 matched files of 80 total files |
|
5.3 GB |
||
/04 Domain 3 Processing/059 EMR Promises Intro to Hadoop.mp4 |
21.6 MB |
Showing first 1 matched files of 138 total files |
|
359.8 MB |
||
/Udemy - Big Data Training Course 2021/3. Classic Hadoop Spark and Flink.mp4 |
32.7 MB |
/Udemy - Big Data Training Course 2021/1. Big Data - Hadoop.mp4 |
24.4 MB |
/Udemy - Big Data Training Course 2021/7. Programming Hadoop.mp4 |
24.4 MB |
/Udemy - Big Data Training Course 2021/8. Big Data - Hadoop Infrastructure.mp4 |
23.5 MB |
/Udemy - Big Data Training Course 2021/9. Hadoop Distriuted File System.mp4 |
33.4 MB |
Showing first 5 matched files of 14 total files |
|
1.1 GB |
||
|
45.1 MB |
|
52.1 MB |
Showing first 2 matched files of 35 total files |
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
/4. Domain 3 Processing/15. EMR Promises; Intro to Hadoop.mp4 |
21.6 MB |
/4. Domain 3 Processing/15. EMR Promises; Intro to Hadoop.srt |
6.1 KB |
/4. Domain 3 Processing/28. [Quiz] EMR and the Hadoop Ecosystem.html |
0.1 KB |
Showing first 3 matched files of 612 total files |
[Яндекс.Практикум] Инженер данных. Data Engineer. Весь курс (2022) |
|
6.8 GB |
|
/07 Организация Data Lake/02 Проектирование Data Lake/04 Знакомство с Hadoop.html |
26.3 KB |
/07 Организация Data Lake/02 Проектирование Data Lake/data_files/Hadoop_1659099426.png |
57.3 KB |
Showing first 2 matched files of 2280 total files |
|
698.5 MB |
||
|
2.2 MB |
|
24.8 MB |
|
3.2 MB |
|
17.3 MB |
|
6.4 MB |
Showing first 5 matched files of 90 total files |
[Rebrain] Архитектор высоких нагрузок Практикум HighLoad (2021) |
|
9.4 GB |
|
|
394.6 KB |
|
1.1 MB |
|
123.7 KB |
|
81.2 KB |
|
180.7 KB |
Showing first 5 matched files of 104 total files |
|
16.8 MB |
||
|
15.3 MB |
Showing first 1 matched files of 5 total files |
|
12.3 MB |
||
|
10.8 MB |
Showing first 1 matched files of 5 total files |
|
11.0 MB |
||
|
9.5 MB |
Showing first 1 matched files of 5 total files |
|
10.6 MB |
||
|
9.1 MB |
Showing first 1 matched files of 5 total files |
Copyright © 2025 FileMood.com