Desirecourse netudemyawscertifieddataanalyticsspecialty2020exbigdata Domain Processing 15 EMR Promises Intro to Hadoop mp4

Desirecourse netudemyawscertifieddataanalyticsspecialty2020exbigdata
Domain Processing 15 EMR Promises Intro to Hadoop mp4

Name	desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata	DOWNLOAD Copy Link Trouble downloading? see How To
Total Size	6.7 GB
Total Files	612
Hash	07E7A0665C6F5E503F6139889A05E32D09876CD0

/4. Domain 3 Processing/15. EMR Promises; Intro to Hadoop.mp4	21.6 MB
/4. Domain 3 Processing/15. EMR Promises; Intro to Hadoop.srt	6.1 KB
/4. Domain 3 Processing/21. Presto on EMR.mp4	26.1 MB
/4. Domain 3 Processing/25. EMR Security and Instance Types.mp4	48.4 MB
/4. Domain 3 Processing/6. [Exercise] AWS Lambda.mp4	79.7 MB
/4. Domain 3 Processing/11. Glue Costs and Anti-Patterns.mp4	15.4 MB
/4. Domain 3 Processing/16. Intro to Apache Spark.mp4	29.8 MB
/4. Domain 3 Processing/18. Hive on EMR.mp4	54.7 MB
/4. Domain 3 Processing/19. Pig on EMR.mp4	19.6 MB
/4. Domain 3 Processing/14. EMR, AWS integration, and Storage.mp4	53.7 MB
/4. Domain 3 Processing/2. What is AWS Lambda.mp4	23.6 MB
/4. Domain 3 Processing/20. HBase on EMR.mp4	28.6 MB
/4. Domain 3 Processing/21. Presto on EMR.srt	4.8 KB
/4. Domain 3 Processing/3. Lambda Integration - Part 1.mp4	44.9 MB
/4. Domain 3 Processing/30. AWS Step Functions.mp4	20.2 MB
Showing first 15 files of 612 total files