FileMood

Showing results 1360 to 1379 of about 5000 for lambda

Udemy, Abdul Bari - Learn C++ Programming - Beginner to Advance - Deep Dive in C++ (05.2020)

31.4 GB

24. C++ 11/3. Lambda Expressions.mp4

137.0 MB

24. C++ 11/4. Demo - Lambda Expressions.mp4

51.4 MB

24. C++ 11/4. Demo - Lambda Expressions.srt

10.2 KB

24. C++ 11/3. Lambda Expressions.srt

7.7 KB
 

Showing first 4 matched files of 828 total files

[FreeCourseSite.com] Udemy - Learn Python Programming Masterclass

43.5 GB

12 - Generators Comprehensions and the timeit module/412 - Source Code Generators Comprehensions and Lambda Expressions Generators and Yield.txt

0.1 KB

12 - Generators Comprehensions and the timeit module/413 - Source Code Generators Comprehensions and Lambda Expressions Next and Ranges.txt

0.1 KB

12 - Generators Comprehensions and the timeit module/414 - Source Code Generators Comprehensions and Lambda Expressions Generator Examples.txt

0.1 KB

12 - Generators Comprehensions and the timeit module/418 - Source Code Generators Comprehensions and Lambda Expressions List Comprehensions.txt

0.1 KB

12 - Generators Comprehensions and the timeit module/419 - Source Code Generators Comprehensions and Lambda Expressions List Comprehensions and SideEffects.txt

0.1 KB
 

Showing first 5 matched files of 9110 total files

[Fanbox] lambda(jpg+gif) (1340 pics).zip

5.8 GB

[ DevCourseWeb.com ] Udemy - Terraform For Aws - From Zero To Hero

1.4 GB

~Get Your Files Here !/9 - Terraform and Lambda functions/49 - Terraform Deploy Lambda functions.mp4

114.3 MB
 

Showing first 1 matched files of 64 total files

[FreeCourseSite.com] Udemy - Learn Python Programming Masterclass

6.3 GB

12 - Generators Comprehensions and the timeit module/412 - Source Code Generators Comprehensions and Lambda Expressions Generators and Yield.txt

0.1 KB

12 - Generators Comprehensions and the timeit module/413 - Source Code Generators Comprehensions and Lambda Expressions Next and Ranges.txt

0.1 KB

12 - Generators Comprehensions and the timeit module/414 - Source Code Generators Comprehensions and Lambda Expressions Generator Examples.txt

0.1 KB

12 - Generators Comprehensions and the timeit module/418 - Source Code Generators Comprehensions and Lambda Expressions List Comprehensions.txt

0.1 KB

12 - Generators Comprehensions and the timeit module/419 - Source Code Generators Comprehensions and Lambda Expressions List Comprehensions and SideEffects.txt

0.1 KB
 

Showing first 5 matched files of 8394 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

03 - SDLC Automation (Domain 1)/009 CodeCommit - & AWS Lambda.mkv

63.7 MB

03 - SDLC Automation (Domain 1)/028 CodeDeploy - Deploy to AWS Lambda.mkv

70.7 MB

03 - SDLC Automation (Domain 1)/037 CodePipeline - Custom Action Jobs with AWS Lambda.mkv

104.1 MB

04 - Configuration Management and Infrastructure as Code (Domain 2)/026 CloudFormation - Deploying Lambda Functions.mkv

115.2 MB

04 - Configuration Management and Infrastructure as Code (Domain 2)/045 Lambda - Overview.mkv

99.4 MB
 

Showing first 5 matched files of 234 total files

Java.COMPLETO.2020.Programação.Orientada.a.Objetos.+Projetos

30.8 GB

20. Programação funcional e expressões lambda/1. Visão geral do capítulo Programação Funcional e Expressões Lambda.mp4

36.1 MB

20. Programação funcional e expressões lambda/2. Material de apoio do capítulo.html

0.4 KB

20. Programação funcional e expressões lambda/2.1 15-programacao-funcional-expressoes-lambda(espaco-para-anotacoes).pdf.pdf

201.5 KB

20. Programação funcional e expressões lambda/2.2 15-programacao-funcional-expressoes-lambda.pdf.pdf

204.4 KB

20. Programação funcional e expressões lambda/3. Uma experiência com Comparator.mp4

213.6 MB
 

Showing first 5 matched files of 403 total files

[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

03 - SDLC Automation (Domain 1)/009 CodeCommit - & AWS Lambda.mkv

63.7 MB

03 - SDLC Automation (Domain 1)/028 CodeDeploy - Deploy to AWS Lambda.mkv

70.7 MB

03 - SDLC Automation (Domain 1)/037 CodePipeline - Custom Action Jobs with AWS Lambda.mkv

104.1 MB

04 - Configuration Management and Infrastructure as Code (Domain 2)/026 CloudFormation - Deploying Lambda Functions.mkv

115.2 MB

04 - Configuration Management and Infrastructure as Code (Domain 2)/045 Lambda - Overview.mkv

99.4 MB
 

Showing first 5 matched files of 242 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

4. Domain 3 Processing/2. What is AWS Lambda.mp4

23.6 MB

4. Domain 3 Processing/2. What is AWS Lambda.srt

8.7 KB

4. Domain 3 Processing/3. Lambda Integration - Part 1.mp4

44.9 MB

4. Domain 3 Processing/3. Lambda Integration - Part 1.srt

9.7 KB

4. Domain 3 Processing/4. Lambda Integration - Part 2.mp4

35.3 MB
 

Showing first 5 matched files of 612 total files

TeamTreehouse - Intermediate C# (Track) [Thomas]

1.7 GB

01. Querying With LINQ/02. Functional Programming in C#/04. Lambda Expressions.webm

11.4 MB

01. Querying With LINQ/02. Functional Programming in C#/Project Files/LINQ-LambdaExpressions.zip

3.2 KB
 

Showing first 2 matched files of 110 total files

[Fanbox+Fantia] Lambda (667 pics) (2048x, q98jpeg).7z

498.0 MB

VA - Future Trance (1997-2022) MP3

53.1 GB

1999 - Future Trance Vol. 7/CD2/09. Lambda - Hold On Tight 2000 (Future Breeze Radio Mix).mp3

7.3 MB

2000 - Future Trance Vol. 11/CD2/17. Lambda - New York (Future Breeze Single Edit).mp3

8.4 MB

2003 - Future Trance Vol. 24/CD2/19. Lambda - Hold On Tight (Kaylab & Reloop Mix).mp3

8.8 MB
 

Showing first 3 matched files of 6099 total files

Beatport Synthwave Sound Pack #558

1.7 GB

004. Apex Shift - Lambda.mp3

5.8 MB
 

Showing first 1 matched files of 132 total files

Bootcamp.Spring.boot.3.0

22.9 GB

04. Java e Orientação a Objetos/17. Programação funcional, expressões lambda/17-01 Visão geral do capítulo.mp4

8.7 MB

04. Java e Orientação a Objetos/17. Programação funcional, expressões lambda/17-02 Uma experiência com Comparator.mp4

82.5 MB

04. Java e Orientação a Objetos/17. Programação funcional, expressões lambda/17-03 Programação funcional e cálculo lambda.mp4

57.3 MB

04. Java e Orientação a Objetos/17. Programação funcional, expressões lambda/17-04 Interface funcional.mp4

12.0 MB

04. Java e Orientação a Objetos/17. Programação funcional, expressões lambda/17-05 Predicate.mp4

66.6 MB
 

Showing first 5 matched files of 377 total files

[ FreeCourseWeb.com ] Udemy - AWS DevOps - Build dynamic Website using S3,Lambda and CDN

677.4 MB

~Get Your Files Here !/1. Introduction and Concepts/3. What is Serverless and Lambda.mp4

35.4 MB

~Get Your Files Here !/1. Introduction and Concepts/3. What is Serverless and Lambda.srt

7.6 KB

~Get Your Files Here !/2. Lab Activity/4. Creation of a Lambda Function and Hosting a Dynamic Website.mp4

157.3 MB

~Get Your Files Here !/2. Lab Activity/4. Creation of a Lambda Function and Hosting a Dynamic Website.srt

19.1 KB
 

Showing first 4 matched files of 20 total files

[Fanbox] lambda(jpg+gif) (1300 pics).zip

5.6 GB

[FreeCourseSite.com] Udemy - Android 12 Jetpack Compose Developer Course - From 0 To Hero

7.1 GB

5. More Fundamentals of Kotlin/9. Lambda Expressions.mp4

18.5 MB

5. More Fundamentals of Kotlin/9. Lambda Expressions.srt

6.9 KB
 

Showing first 2 matched files of 223 total files

[ TutGator.com ] Udemy - Python for Algorithmic trading - Technical analysis strategy

1.6 GB

~Get Your Files Here !/2. Basics of Python/14. Functions Lambda function.mp4

15.5 MB

~Get Your Files Here !/2. Basics of Python/14. Functions Lambda function.srt

1.4 KB
 

Showing first 2 matched files of 116 total files

[FreeCourseSite.com] Udemy - 2023 Become AWS SageMaker ML Engineer in 30 Days + ChatGPT

20.6 GB

38 - Day 29 Lambda Functions Using AWS Console/0. Websites you may like/[CourseClub.Me].url

0.1 KB

38 - Day 29 Lambda Functions Using AWS Console/0. Websites you may like/[FreeCourseSite.com].url

0.1 KB

38 - Day 29 Lambda Functions Using AWS Console/0. Websites you may like/[GigaCourse.Com].url

0.0 KB

38 - Day 29 Lambda Functions Using AWS Console/001 Day Welcome Message.mp4

5.3 MB

38 - Day 29 Lambda Functions Using AWS Console/001 Day Welcome Message_en.srt

1.2 KB
 

Showing first 5 matched files of 969 total files

Alishev

39.2 GB

04_Продвинутая Java/05 Лямбда - выражения Lambda expressions/033 Лямбда - выражения часть I.mp4

73.0 MB

04_Продвинутая Java/05 Лямбда - выражения Lambda expressions/034 Лямбда - выражения часть II.mp4

77.3 MB
 

Showing first 2 matched files of 833 total files
«« « Back Next » »»

Copyright © 2026 FileMood.com