|
|
5.3 GB |
||
|
/05 Domain 4 Analysis/105 Amazon Relational Database Service (RDS) and Aurora.mp4 |
31.6 MB |
|
Showing first 1 matched files of 138 total files |
|
|
|
359.8 MB |
||
|
/Udemy - Big Data Training Course 2021/11. Relational Databases.mp4 |
13.2 MB |
|
Showing first 1 matched files of 14 total files |
|
|
[ CourseBoat.com ] Linkedin - Java 17 Essential Training - Syntax and Structure |
|
395.8 MB |
|
|
/~Get Your Files Here !/05 - 4. Decision Structures/06 - Relational operators.mp4 |
4.5 MB |
|
/~Get Your Files Here !/05 - 4. Decision Structures/06 - Relational operators.srt |
3.5 KB |
|
Showing first 2 matched files of 191 total files |
|
|
[ CourseLala.com ] Udemy - Verilog HDL Fundamentals for Digital Design and Verification |
|
3.6 GB |
|
|
/~Get Your Files Here !/3. Verilog Data Types and Operators/20. Verilog Operators - Relational.mp4 |
6.6 MB |
|
/~Get Your Files Here !/3. Verilog Data Types and Operators/20. Verilog Operators - Relational.srt |
0.6 KB |
|
|
11.0 MB |
|
|
1.4 KB |
|
/~Get Your Files Here !/3. Verilog Data Types and Operators/21.1 relational_operators.v |
0.5 KB |
|
Showing first 5 matched files of 421 total files |
|
|
[ DevCourseWeb.com ] Udemy - AP Computer Science A - Java Programming Fundamentals |
|
1.3 GB |
|
|
/~Get Your Files Here !/2. Unit 3 Boolean Expressions and if Statements/1. Relational Operators.mp4 |
65.5 MB |
|
/~Get Your Files Here !/2. Unit 3 Boolean Expressions and if Statements/1. Relational Operators.srt |
23.1 KB |
|
Showing first 2 matched files of 104 total files |
|
|
[ DevCourseWeb.com ] Udemy - GraphQL with React and Node js - Real Time Private Chat App |
|
3.1 GB |
|
|
/~Get Your Files Here !/2. GraphQL basics/4. parent argument for relational data.mp4 |
61.2 MB |
|
/~Get Your Files Here !/2. GraphQL basics/4. parent argument for relational data.srt |
11.0 KB |
|
Showing first 2 matched files of 79 total files |
|
|
[FreeCourseSite.com] Udemy - Beginning C++ Programming - From Beginner to Beyond |
|
12.7 GB |
|
|
|
20.4 MB |
|
/08 - Statements and Operators/009 Relational Operators_en.srt |
6.6 KB |
|
Showing first 2 matched files of 693 total files |
|
|
[FreeCourseSite.com] Udemy - Hibernate and Spring Data JPA Beginner to Guru |
|
4.1 GB |
|
|
/3. Introduction to MySQL/3. Relational Database Principles.mp4 |
71.4 MB |
|
|
3.5 MB |
|
/3. Introduction to MySQL/4. What is a Relational Database Management System.mp4 |
44.1 MB |
|
Showing first 3 matched files of 260 total files |
|
|
Dori Friend - SEO Rockstars Recordings 2022 (www.imarketing.courses) |
|
13.7 GB |
|
|
/14-Advanced SEO Strategies using Tested & Correlational Data - Honey Witcher.mp4 |
496.0 MB |
|
Showing first 1 matched files of 42 total files |
|
|
[GigaCourse.Com] Udemy - Complete NodeJS Developer in 2022 GraphQL MongoDB plus more |
|
23.2 GB |
|
|
|
4.1 GB |
||
|
/06- ADVANCED QUERIES/Module Resources/02-Flatten GA4 Schema For Relational Databases.rtf |
211.7 KB |
|
/06- ADVANCED QUERIES/02-Flatten GA4 Schema For Relational Databases.mp4 |
139.2 MB |
|
Showing first 2 matched files of 248 total files |
|
|
free-course-site.com-udemy-learn-c-programming-from-beginner-to-expert-2019 |
|
10.6 GB |
|
|
|
64.4 MB |
|
|
5.6 KB |
|
|
0.5 KB |
|
Showing first 3 matched files of 596 total files |
|
|
[ DevCourseWeb.com ] Udemy - Terraform For Aws - From Zero To Hero |
|
1.4 GB |
|
|
/~Get Your Files Here !/7 - RDS Relational Database Service/37 - Create RDS Instance.mp4 |
13.8 MB |
|
|
14.5 MB |
|
/~Get Your Files Here !/7 - RDS Relational Database Service/39 - RDS Configure Security Group.mp4 |
12.3 MB |
|
|
7.6 MB |
|
/~Get Your Files Here !/7 - RDS Relational Database Service/41 - 5 RDS Autoscaling Storage.mp4 |
7.9 MB |
|
Showing first 5 matched files of 64 total files |
|
|
|
188.4 MB |
||
|
|
3.1 MB |
|
|
5.2 MB |
|
|
17.5 MB |
|
Showing first 3 matched files of 48 total files |
|
|
[GigaCourse.Com] Udemy - The JavaScript Bible - JavaScript Bootcamp |
|
16.1 GB |
|
|
/24 - Introduction to the MongoDB/002 LECTURE - Relational vs Document Databases.mp4 |
2.3 MB |
|
/24 - Introduction to the MongoDB/002 LECTURE - Relational vs Document Databases_en.srt |
2.0 KB |
|
Showing first 2 matched files of 799 total files |
|
|
|
19.3 GB |
||
|
/1. Introduction to Programming with JS [Recorded]/09. Relational Operators.mp4 |
63.9 MB |
|
Showing first 1 matched files of 98 total files |
|
|
[GigaCourse.Com] Udemy - Java for complete beginners Learn core java using IntelliJ |
|
3.8 GB |
|
|
/03 - Variables, Datatypes and Operators in Java/014 Relational Operators in Java.mp4 |
13.6 MB |
|
/03 - Variables, Datatypes and Operators in Java/014 Relational Operators in Java_en.vtt |
5.3 KB |
|
/03 - Variables, Datatypes and Operators in Java/22075102-Relational-Operators-in-Java.pdf |
40.6 KB |
|
Showing first 3 matched files of 602 total files |
|
|
[ DevCourseWeb.com ] Udemy - JDBC, DAO and SQL - Practical Crash Course - Build Database App |
|
3.6 GB |
|
|
/~Get Your Files Here !/03 - Relational databases/001 Relational Databases Basic Concepts.mp4 |
150.4 MB |
|
/~Get Your Files Here !/03 - Relational databases/001 Relational Databases Basic Concepts_en.srt |
34.8 KB |
|
|
271.6 MB |
|
|
48.4 KB |
|
|
178.6 MB |
|
Showing first 5 matched files of 61 total files |
|
|
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
|
/6. Domain 4 Analysis/28. Amazon Relational Database Service (RDS) and Aurora.mp4 |
31.6 MB |
|
/6. Domain 4 Analysis/28. Amazon Relational Database Service (RDS) and Aurora.srt |
6.5 KB |
|
Showing first 2 matched files of 612 total files |
|
|
|
7.5 GB |
||
|
|
5.7 MB |
|
|
7.0 KB |
|
Showing first 2 matched files of 1936 total files |
|
Copyright © 2025 FileMood.com