FileMood

Showing results 940 to 959 of about 5000 for troubleshooting

troubleshooting_202002

317.3 MB

/troubleshooting_202002_meta.sqlite

11.3 KB

/troubleshooting_202002_meta.xml

1.0 KB

 

Showing first 2 matched files of 5 total files

The Creative Copywriter Academy - The Freelance Copywriter Kickstarter Course (www.imarketing.courses)

3.0 GB

/04-The Discovery Stage - The Brand/08-Tone of Voice Masterclass 4 - Troubleshooting TOV issues with clients.mp4

50.2 MB

 

Showing first 1 matched files of 156 total files

Dr. Hemmel Amrania - Passive Affiliate Blueprint (www.imarketing.courses)

4.5 GB

/07- Frequently Asked Questions & Troubleshooting/01-How Do I Use The Offer Viability Calculator For Fixed Commissions-.mp4

12.4 MB

/07- Frequently Asked Questions & Troubleshooting/02-How Do I access The Full Data In Google Keyword Planner-.mp4

100.6 MB

/07- Frequently Asked Questions & Troubleshooting/03-Affiliate Links From Networks.mp4

28.5 MB

/07- Frequently Asked Questions & Troubleshooting/04-Why Would I Approach A Company Directly To Become Their Affiliate .mp4

68.3 MB

/07- Frequently Asked Questions & Troubleshooting/05-What To Say When Approaching Companies.mp4

261.9 MB

 

Showing first 5 matched files of 65 total files

Jason Pantana - Digital Marketing Complete Course (www.imarketing.courses)

12.8 GB

/02-Marketing Pro - Google Business Boss/05-Troubleshooting Technical Issues That’ll Short-Circuit GBP Performance/01-Troubleshooting Technical Issues Introduction.ts

10.3 MB

/02-Marketing Pro - Google Business Boss/05-Troubleshooting Technical Issues That’ll Short-Circuit GBP Performance/02-Physical Address OUTSIDE of Your Service Area.mp4

43.9 MB

/02-Marketing Pro - Google Business Boss/05-Troubleshooting Technical Issues That’ll Short-Circuit GBP Performance/03-How to Manage Missing or Filtered Reviews.mp4

66.9 MB

/02-Marketing Pro - Google Business Boss/05-Troubleshooting Technical Issues That’ll Short-Circuit GBP Performance/04-Dealing with Duplicate Profiles.mp4

56.6 MB

/02-Marketing Pro - Google Business Boss/05-Troubleshooting Technical Issues That’ll Short-Circuit GBP Performance/05-Google’s Randomly Published Updates.mp4

96.8 MB

 

Showing first 5 matched files of 126 total files

The_7th_Guest_Reissue_USA

924.7 MB

/19. Troubleshooting Guide.jpg

484.3 KB

/19. Troubleshooting Guide_thumb.jpg

8.1 KB

 

Showing first 2 matched files of 55 total files

[GigaCourse.Com] Udemy - The Complete 2023 Web Development Bootcamp

27.1 GB

/38 - React.js/017 Newer Versions of Node Troubleshooting.html

1.2 KB

 

Showing first 1 matched files of 1098 total files

[GigaCourse.Com] Udemy - Complete Ethical Hacking Bootcamp 2023 Zero to Mastery

10.9 GB

/02 - Setting Up Our Hacking Lab/011 Troubleshooting Network Connection in Kali Linux.mp4

53.8 MB

/02 - Setting Up Our Hacking Lab/011 Troubleshooting Network Connection in Kali Linux_en.srt

10.4 KB

 

Showing first 2 matched files of 541 total files

[ DevCourseWeb.com ] Udemy - Apple Mac Os X Mavericks - Beyond The Basics

1.5 GB

/~Get Your Files Here !/10 - Protecting Mac OS X With Passwords/65 - Keychain And Password Troubleshooting English.vtt

8.6 KB

/~Get Your Files Here !/10 - Protecting Mac OS X With Passwords/65 - Keychain And Password Troubleshooting.mp4

16.5 MB

 

Showing first 2 matched files of 240 total files

[ DevCourseWeb.com ] Udemy - Data Warehouse & Power BI For Beginners -DW ,SSIS, ETL, BI

4.0 GB

/~Get Your Files Here !/9. Debugging and Troubleshooting SSIS Packages/1. Debugging SSIS Package Part 1.mp4

57.3 MB

/~Get Your Files Here !/9. Debugging and Troubleshooting SSIS Packages/1. Debugging SSIS Package Part 1.srt

8.1 KB

/~Get Your Files Here !/9. Debugging and Troubleshooting SSIS Packages/2. Debugging SSIS Package Part 2.mp4

63.0 MB

/~Get Your Files Here !/9. Debugging and Troubleshooting SSIS Packages/2. Debugging SSIS Package Part 2.srt

8.5 KB

/~Get Your Files Here !/9. Debugging and Troubleshooting SSIS Packages/3. Logging SSIS Package Events.mp4

73.0 MB

 

Showing first 5 matched files of 195 total files

[ FreeCourseWeb.com ] Udemy - Power BI - Keeping it simple

1.5 GB

/~Get Your Files Here !/06 Visualizations/002 Troubleshooting.en.srt

16.0 KB

/~Get Your Files Here !/06 Visualizations/002 Troubleshooting.mp4

178.4 MB

 

Showing first 2 matched files of 51 total files

CompTIA Server + (SK0-005) - ITProTV

10.9 GB

/4-Troubleshooting/1-Troubleshooting Methodology.mp4

243.3 MB

/4-Troubleshooting/2-Hardware Components.mp4

268.6 MB

/4-Troubleshooting/3-System Crashes and Lockups.mp4

212.9 MB

/4-Troubleshooting/4-Storage Issues and Tools.mp4

289.5 MB

/4-Troubleshooting/5-OS Issues and Tools.mp4

255.5 MB

 

Showing first 5 matched files of 43 total files

Submeta - Unsweepable

7.3 GB

/Opening Closed Guard/7 - Standing Position Troubleshooting/1 - Single Underhook.mp4

71.8 MB

/Opening Closed Guard/7 - Standing Position Troubleshooting/2 - Gripping Both Legs.mp4

38.3 MB

/Stripping Grips to Pass/Opening Closed Guard/7 - Standing Position Troubleshooting/1 - Single Underhook.mp4

71.8 MB

/Stripping Grips to Pass/Opening Closed Guard/7 - Standing Position Troubleshooting/2 - Gripping Both Legs.mp4

38.3 MB

 

Showing first 4 matched files of 166 total files

Peachpit - macOS Support Essentials 10.14 - Apple Pro Training Series - Supporting and Troubleshooting macOS Mojave - Adam Karneboge, Arek Dreyer - Jan 2019.rar

107.4 MB

[ TutGee.com ] Desktop Support IT Support IT Fundamentals Training Course (2021)

1.9 GB

/~Get Your Files Here !/1. Introduction/3. What is Troubleshooting.mp4

146.3 MB

/~Get Your Files Here !/1. Introduction/3. What is Troubleshooting.srt

11.8 KB

 

Showing first 2 matched files of 58 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

/04 - Configuration Management and Infrastructure as Code (Domain 2)/016 CloudFormation cfn-signal failures troubleshooting.mkv

26.1 MB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/009 ASG - Suspending Processes & Troubleshooting.mkv

120.2 MB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/017 ASG - CodeDeploy Integration Troubleshooting.mkv

30.8 MB

 

Showing first 3 matched files of 234 total files

[ CourseBoat.com ] Udemy - DNS Bind - step by step

1.3 GB

/~Get Your Files Here !/2. Level Beginner - DNS Bind (Lab)/8. Lab 4 Troubleshooting DNS.mp4

68.9 MB

 

Showing first 1 matched files of 58 total files

[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

/04 - Configuration Management and Infrastructure as Code (Domain 2)/016 CloudFormation cfn-signal failures troubleshooting.mkv

26.1 MB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/009 ASG - Suspending Processes & Troubleshooting.mkv

120.2 MB

/07 - Incident and Event Response (Domain 5) & HA, Fault Tolerance, and DR (Domain 6)/017 ASG - CodeDeploy Integration Troubleshooting.mkv

30.8 MB

 

Showing first 3 matched files of 242 total files

Cisco Certified DevNet Associate DEVASC 200-901

3.3 GB

/Module 3 Understanding and Using APIs/Lesson 13 Making an API Call With Python/004. 13.3 Troubleshooting API Calls en.srt

14.6 KB

/Module 3 Understanding and Using APIs/Lesson 13 Making an API Call With Python/004. 13.3 Troubleshooting API Calls.mp4

29.3 MB

/Module 5 Network Fundamentals/Lesson 22 Troubleshooting Application Connectivity/001. Learning Objectives en.srt

0.6 KB

/Module 5 Network Fundamentals/Lesson 22 Troubleshooting Application Connectivity/001. Learning Objectives.mp4

2.5 MB

/Module 5 Network Fundamentals/Lesson 22 Troubleshooting Application Connectivity/002. 22.1 Interpreting Network Diagrams en.srt

5.4 KB

 

Showing first 5 matched files of 344 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/2. Domain 1 Collection/12. Troubleshooting Info for the Following Exercise.html

0.7 KB

 

Showing first 1 matched files of 612 total files

Craft eLibrary pt 6

796.9 MB

/Silk Painting/118-Troubleshooting.jpg

1.3 MB

 

Showing first 1 matched files of 747 total files


Copyright © 2025 FileMood.com