|
317.3 MB |
||
|
11.3 KB |
|
1.0 KB |
Showing first 2 matched files of 5 total files |
|
3.0 GB |
||
|
50.2 MB |
Showing first 1 matched files of 156 total files |
Dr. Hemmel Amrania - Passive Affiliate Blueprint (www.imarketing.courses) |
|
4.5 GB |
|
|
12.4 MB |
|
100.6 MB |
/07- Frequently Asked Questions & Troubleshooting/03-Affiliate Links From Networks.mp4 |
28.5 MB |
|
68.3 MB |
/07- Frequently Asked Questions & Troubleshooting/05-What To Say When Approaching Companies.mp4 |
261.9 MB |
Showing first 5 matched files of 65 total files |
Jason Pantana - Digital Marketing Complete Course (www.imarketing.courses) |
|
12.8 GB |
|
|
10.3 MB |
|
43.9 MB |
|
66.9 MB |
|
56.6 MB |
|
96.8 MB |
Showing first 5 matched files of 126 total files |
|
924.7 MB |
||
|
484.3 KB |
|
8.1 KB |
Showing first 2 matched files of 55 total files |
[GigaCourse.Com] Udemy - The Complete 2023 Web Development Bootcamp |
|
27.1 GB |
|
/38 - React.js/017 Newer Versions of Node Troubleshooting.html |
1.2 KB |
Showing first 1 matched files of 1098 total files |
[GigaCourse.Com] Udemy - Complete Ethical Hacking Bootcamp 2023 Zero to Mastery |
|
10.9 GB |
|
/02 - Setting Up Our Hacking Lab/011 Troubleshooting Network Connection in Kali Linux.mp4 |
53.8 MB |
/02 - Setting Up Our Hacking Lab/011 Troubleshooting Network Connection in Kali Linux_en.srt |
10.4 KB |
Showing first 2 matched files of 541 total files |
[ DevCourseWeb.com ] Udemy - Apple Mac Os X Mavericks - Beyond The Basics |
|
1.5 GB |
|
|
8.6 KB |
|
16.5 MB |
Showing first 2 matched files of 240 total files |
[ DevCourseWeb.com ] Udemy - Data Warehouse & Power BI For Beginners -DW ,SSIS, ETL, BI |
|
4.0 GB |
|
|
57.3 MB |
|
8.1 KB |
|
63.0 MB |
|
8.5 KB |
|
73.0 MB |
Showing first 5 matched files of 195 total files |
|
1.5 GB |
||
/~Get Your Files Here !/06 Visualizations/002 Troubleshooting.en.srt |
16.0 KB |
/~Get Your Files Here !/06 Visualizations/002 Troubleshooting.mp4 |
178.4 MB |
Showing first 2 matched files of 51 total files |
|
10.9 GB |
||
|
243.3 MB |
|
268.6 MB |
|
212.9 MB |
|
289.5 MB |
|
255.5 MB |
Showing first 5 matched files of 43 total files |
|
7.3 GB |
||
/Opening Closed Guard/7 - Standing Position Troubleshooting/1 - Single Underhook.mp4 |
71.8 MB |
/Opening Closed Guard/7 - Standing Position Troubleshooting/2 - Gripping Both Legs.mp4 |
38.3 MB |
|
71.8 MB |
|
38.3 MB |
Showing first 4 matched files of 166 total files |
|
107.4 MB |
||
[ TutGee.com ] Desktop Support IT Support IT Fundamentals Training Course (2021) |
|
1.9 GB |
|
/~Get Your Files Here !/1. Introduction/3. What is Troubleshooting.mp4 |
146.3 MB |
/~Get Your Files Here !/1. Introduction/3. What is Troubleshooting.srt |
11.8 KB |
Showing first 2 matched files of 58 total files |
[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On! |
|
10.3 GB |
|
|
26.1 MB |
|
120.2 MB |
|
30.8 MB |
Showing first 3 matched files of 234 total files |
|
1.3 GB |
||
/~Get Your Files Here !/2. Level Beginner - DNS Bind (Lab)/8. Lab 4 Troubleshooting DNS.mp4 |
68.9 MB |
Showing first 1 matched files of 58 total files |
[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On! |
|
10.3 GB |
|
|
26.1 MB |
|
120.2 MB |
|
30.8 MB |
Showing first 3 matched files of 242 total files |
|
3.3 GB |
||
|
14.6 KB |
|
29.3 MB |
|
0.6 KB |
|
2.5 MB |
|
5.4 KB |
Showing first 5 matched files of 344 total files |
desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata |
|
6.7 GB |
|
/2. Domain 1 Collection/12. Troubleshooting Info for the Following Exercise.html |
0.7 KB |
Showing first 1 matched files of 612 total files |
|
796.9 MB |
||
|
1.3 MB |
Showing first 1 matched files of 747 total files |
Copyright © 2025 FileMood.com