FileMood

Showing results 1020 to 1039 of about 5000 for instance

The.Witcher.3.Wild.Hunt.Complete.Edition.Next.Gen-InsaneRamZes

95.6 GB

/content/content0/scripts/game/behavior_tree/conditions/btCondIsInStance.ws

2.1 KB

/content/content0/scripts/game/behavior_tree/tasks/custom/btTaskManageFXInstance.ws

5.3 KB

 

Showing first 2 matched files of 2976 total files

Terraform

2.3 GB

/3. Implementing Terraform on Microsoft Azure/03-02 - Creating Multiple Providers -- Using Multiple Instances.mp4

2.2 MB

/1. Terraform - Getting Started/06-10 - Adding a New Provider to Your Configuration -- Updating the Load Balancer and Instances.mp4

4.6 MB

/3. Implementing Terraform on Microsoft Azure/03-07 - Creating Multiple Providers -- Multiple Instances for Network Peering.mp4

5.5 MB

/1. Terraform - Getting Started/05-05 - Updating Your Configuration with More Resources -- Updating the Network and Instance Configuration.mp4

14.0 MB

/1. Terraform - Getting Started/07-07 - Using Functions and Looping in Your Configuration -- Updating the VPC and Instances.mp4

15.6 MB

 

Showing first 5 matched files of 318 total files

Satisfactory

21.4 GB

/Satisfactory Stable/Engine/Binaries/Win64/FactoryGame-InstancedSplines-Win64-Shipping.dll

269.3 KB

/Satisfactory Stable/Engine/Binaries/Win64/FactoryGame-InstancedSplines-Win64-Shipping.pdb

35.2 MB

/Satisfactory Stable/FactoryGame/Plugins/AbstractInstance/Binaries/Win64/FactoryGame-AbstractInstance-Win64-Shipping.dll

195.6 KB

/Satisfactory Stable/FactoryGame/Plugins/AbstractInstance/Binaries/Win64/FactoryGame-AbstractInstance-Win64-Shipping.pdb

30.2 MB

/Satisfactory Stable/FactoryGame/Plugins/AbstractInstance/Binaries/Win64/FactoryGame-Win64-Shipping.modules

0.1 KB

 

Showing first 5 matched files of 684 total files

U-Nam 19 Cd's

3.1 GB

/2021 U-Nam - Love in Motion (Future Love, Pt. 3) (2021) by pere1109/05 - Instance Girl.mp3

13.1 MB

 

Showing first 1 matched files of 294 total files

Google Cloud Platform Professional Cloud Architect

2.5 GB

/Module 3 Managing and provisioning a solution infrastructure/Lesson 8 Configuring compute systems/004. 8.3 Demo Configuring preemptible instances en.srt

3.2 KB

/Module 3 Managing and provisioning a solution infrastructure/Lesson 8 Configuring compute systems/004. 8.3 Demo Configuring preemptible instances.mp4

9.7 MB

 

Showing first 2 matched files of 282 total files

The.Witcher.3.Wild.Hunt.Complete.Edition.Next.Gen-InsaneRamZes

95.5 GB

/content/content0/scripts/game/behavior_tree/conditions/btCondIsInStance.ws

2.1 KB

/content/content0/scripts/game/behavior_tree/tasks/custom/btTaskManageFXInstance.ws

5.3 KB

 

Showing first 2 matched files of 2961 total files

The.Witcher.3.Wild.Hunt.Complete.Edition.Next.Gen-InsaneRamZes

95.5 GB

/content/content0/scripts/game/behavior_tree/conditions/btCondIsInStance.ws

2.1 KB

/content/content0/scripts/game/behavior_tree/tasks/custom/btTaskManageFXInstance.ws

5.3 KB

 

Showing first 2 matched files of 2961 total files

starboundsourcecode

791.6 MB

/assets/devel/instance_worlds.config.patch

17.1 KB

 

Showing first 1 matched files of 635 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/4. Domain 3 Processing/25. EMR Security and Instance Types.mp4

48.4 MB

/4. Domain 3 Processing/25. EMR Security and Instance Types.srt

10.0 KB

/9. Everything Else/2. Instance Types for Big Data.mp4

16.1 MB

/9. Everything Else/2. Instance Types for Big Data.srt

4.2 KB

 

Showing first 4 matched files of 612 total files

BnS

70.7 GB

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/lib2to3/fixes/fix_isinstance.py

1.7 KB

 

Showing first 1 matched files of 3519 total files

BnS

68.7 GB

/Engine/Binaries/ThirdParty/Python3/Win64/Lib/lib2to3/fixes/fix_isinstance.py

1.7 KB

 

Showing first 1 matched files of 3491 total files

junos-srxsme

74.5 GB

/juniper-configurations/routing-instance-noction

2.9 KB

 

Showing first 1 matched files of 1818 total files

TheWitcher3_Complete_NextGen_Linux

59.9 GB

/game_info/data/content/content0/scripts/game/behavior_tree/conditions/btCondIsInStance.ws

2.1 KB

/game_info/data/content/content0/scripts/game/behavior_tree/tasks/custom/btTaskManageFXInstance.ws

5.3 KB

 

Showing first 2 matched files of 3932 total files

DKonline

11.7 GB

/res/instance_d01_type01.map

19.3 MB

/res/instance_d01_type02.map

19.3 MB

/res/instance_d01_type03.map

19.3 MB

/res/instance_d01_type04.map

19.3 MB

/res/instance_d01_type05.map

19.3 MB

 

Showing first 5 matched files of 1645 total files

Craftopia

23.1 GB

/Craftopia_Data/Managed/InstancedIndirectRenderer.Runtime.dll

22.0 KB

/Craftopia_Data/Managed/InstancedIndirectRenderer.Test.dll

5.1 KB

 

Showing first 2 matched files of 2001 total files

[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

/03 - SDLC Automation (Domain 1)/027 CodeDeploy - On-Premise Instances Setup.mkv

130.0 MB

/06 - Policies and Standards Automation (Domain 4)/021 EC2 Instance Compliance.mkv

10.0 MB

 

Showing first 2 matched files of 242 total files

Skillshare.Basics.of.Oracle.Cloud.Infrastructure.OCI.Provisioning.and.using.Linux.VM.Always.Free.Tier-SkilledHares

1.4 GB

/10-connecting_to_linux_instance-vm_through_putty.mkv

38.6 MB

/09-creating_linux_instance-virtual_machine.mkv

69.2 MB

/06-step_involved_in_creation_of_linux_instance_and_access_through_putty.mkv

162.5 MB

 

Showing first 3 matched files of 25 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

/03 - SDLC Automation (Domain 1)/027 CodeDeploy - On-Premise Instances Setup.mkv

130.0 MB

/06 - Policies and Standards Automation (Domain 4)/021 EC2 Instance Compliance.mkv

10.0 MB

 

Showing first 2 matched files of 234 total files

[DesireCourse.Net] Udemy - The Complete Splunk Beginner Course

1.1 GB

/4. Installing Splunk/1. Provisioning a Splunk Cloud instance.mp4

13.6 MB

/4. Installing Splunk/1. Provisioning a Splunk Cloud instance.vtt

1.2 KB

 

Showing first 2 matched files of 110 total files

[FreeCourseSite.com] Udemy - Learn Python Programming Masterclass

6.3 GB

/10 - Object Oriented Python/337 - Instances Constructors Self and more English.vtt

19.6 KB

/10 - Object Oriented Python/337 - Instances Constructors Self and more Italian.vtt

18.6 KB

/10 - Object Oriented Python/337 - Instances Constructors Self and more Portuguese.vtt

18.7 KB

/10 - Object Oriented Python/337 - Instances Constructors Self and more Spanish.vtt

18.9 KB

/10 - Object Oriented Python/337 - Instances Constructors Self and more Turkish.vtt

18.3 KB

 

Showing first 5 matched files of 8394 total files


Copyright © 2025 FileMood.com