Desirecourse netudemyawscertifieddataanalyticsspecialty2020exbigdata Domain Processing 25 EMR Security and Instance Types mp4

Desirecourse netudemyawscertifieddataanalyticsspecialty2020exbigdata
Domain Processing 25 EMR Security and Instance Types mp4

Name	desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata	DOWNLOAD Copy Link Trouble downloading? see How To
Total Size	6.7 GB
Total Files	612
Hash	07E7A0665C6F5E503F6139889A05E32D09876CD0

/4. Domain 3 Processing/25. EMR Security and Instance Types.mp4	48.4 MB
/4. Domain 3 Processing/25. EMR Security and Instance Types.srt	10.0 KB
/4. Domain 3 Processing/11. Glue Costs and Anti-Patterns.mp4	15.4 MB
/4. Domain 3 Processing/22. Zeppelin and EMR Notebooks.mp4	40.1 MB
/4. Domain 3 Processing/24. S3DistCP and Other Services.mp4	38.7 MB
/4. Domain 3 Processing/15. EMR Promises; Intro to Hadoop.mp4	21.6 MB
/4. Domain 3 Processing/23. Hue, Splunk, and Flume.mp4	32.3 MB
/4. Domain 3 Processing/11. Glue Costs and Anti-Patterns.srt	2.7 KB
/4. Domain 3 Processing/22. Zeppelin and EMR Notebooks.srt	8.1 KB
/4. Domain 3 Processing/24. S3DistCP and Other Services.srt	8.4 KB
/4. Domain 3 Processing/29. AWS Data Pipeline.mp4	47.6 MB
/4. Domain 3 Processing/30. AWS Step Functions.mp4	20.2 MB
/4. Domain 3 Processing/9. Glue, Hive, and ETL.mp4	11.6 MB
/4. Domain 3 Processing/14. EMR, AWS integration, and Storage.mp4	53.7 MB
/4. Domain 3 Processing/15. EMR Promises; Intro to Hadoop.srt	6.1 KB
Showing first 15 files of 612 total files