FileMood

Showing results 23 to 42 of about 147 for sagemaker

UD610

3.6 GB

/aws-certified-cloud-practitioner-new/17 Machine Learning/162 SageMaker Overview.mp4

15.8 MB

 

Showing first 1 matched files of 196 total files

AWS, Azure, Google, and Cloud Security

513.8 MB

/AWS, Azure, Google, and Cloud Security/EPUB/machinelearningintheawscloud_addintelligencetoapplicationswithamazonsagemakerandamazonrekognition.epub

56.5 MB

/AWS, Azure, Google, and Cloud Security/PDF/Machine Learning in the AWS Cloud_ Add Intelligence to Applications with Amazon SageMaker and Amazon Rekognition.pdf

25.9 MB

 

Showing first 2 matched files of 28 total files

[ DevCourseWeb.com ] Introduction to SageMaker.zip

392.2 MB

60 Assorted Magazines PDF December 17 2020 Part 1

3.3 GB

/Covers/Passagemaker January 2021.jpg

197.8 KB

/Magazines/Passagemaker January 2021.pdf

64.1 MB

 

Showing first 2 matched files of 120 total files

50 Assorted Magazines - January 28 2021

3.3 GB

/Covers/PassageMaker – March 2021.jpg

117.3 KB

/PassageMaker – March 2021.pdf

62.1 MB

 

Showing first 2 matched files of 100 total files

60 Assorted Magazines PDF February 25 2021 Pack 4

3.1 GB

/Covers/Passagemaker January 2021.jpg

1.2 MB

/Magazines/Passagemaker January 2021.pdf

64.1 MB

 

Showing first 2 matched files of 120 total files

40 Assorted Magazines PDF March 6 2021 Pack 3

2.7 GB

/Covers/PassageMaker March 2021.jpg

1.1 MB

/Magazines/PassageMaker March 2021.pdf

62.1 MB

 

Showing first 2 matched files of 80 total files

60 Assorted Magazines PDF April 14 2021 Pack 2

3.2 GB

/Covers/Passagemaker January 2021.jpg

1.2 MB

/Magazines/Passagemaker January 2021.pdf

64.1 MB

 

Showing first 2 matched files of 120 total files

UD1

5.3 GB

/04 Domain 3 Processing/075 SageMaker.mp4

52.9 MB

 

Showing first 1 matched files of 138 total files

[GigaCourse.Com] Udemy - 10 Days of No Code Artificial Intelligence Bootcamp

7.1 GB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/1. Introduction Day 9.mp4

36.0 MB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/1. Introduction Day 9.srt

2.1 KB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/10. Task 6. Delete Endpoint.mp4

11.0 MB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/10. Task 6. Delete Endpoint.srt

2.7 KB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/11. Task 7. Final Project Overview.mp4

26.0 MB

 

Showing first 5 matched files of 239 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/5. Machine Learning AWS Certified Big Data exam only!/10. Quiz Amazon Machine Learning and SageMaker.html

0.1 KB

/5. Machine Learning AWS Certified Big Data exam only!/5. SageMaker.mp4

52.9 MB

/5. Machine Learning AWS Certified Big Data exam only!/5. SageMaker.srt

14.0 KB

 

Showing first 3 matched files of 612 total files

60 Assorted Magazines Collection PDF October 3 2022 Set 9

2.7 GB

/Covers/Passagemaker October 2022.jpg

160.7 KB

/Magazines/Passagemaker October 2022.pdf

101.9 MB

 

Showing first 2 matched files of 122 total files

[FreeCourseSite.com] Udemy - 10 Days of No Code Artificial Intelligence Bootcamp

7.1 GB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/1. Introduction Day 9.mp4

36.0 MB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/1. Introduction Day 9.srt

2.1 KB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/10. Task 6. Delete Endpoint.mp4

11.0 MB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/10. Task 6. Delete Endpoint.srt

2.7 KB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/11. Task 7. Final Project Overview.mp4

26.0 MB

 

Showing first 5 matched files of 238 total files

_TensorFlow

6.7 GB

/Pluralsight Path. Building Machine Learning Solutions with TensorFlow (2019)/B2. Deploying TensorFlow Models to AWS, Azure, and the GCP (Janani Ravi, 2018)/4. Deploying TensorFlow Models on Amazon AWS/02. The Machine Learning Workflow - SageMaker.mp4

5.9 MB

/Pluralsight Path. Building Machine Learning Solutions with TensorFlow (2019)/B2. Deploying TensorFlow Models to AWS, Azure, and the GCP (Janani Ravi, 2018)/4. Deploying TensorFlow Models on Amazon AWS/02. The Machine Learning Workflow - SageMaker.vtt

5.9 KB

/Pluralsight Path. Building Machine Learning Solutions with TensorFlow (2019)/B2. Deploying TensorFlow Models to AWS, Azure, and the GCP (Janani Ravi, 2018)/5. Deploying TensorFlow Models on the Google Cloud Platform/02. Cloud ML Engine vs. SageMaker.mp4

7.4 MB

/Pluralsight Path. Building Machine Learning Solutions with TensorFlow (2019)/B2. Deploying TensorFlow Models to AWS, Azure, and the GCP (Janani Ravi, 2018)/5. Deploying TensorFlow Models on the Google Cloud Platform/02. Cloud ML Engine vs. SageMaker.vtt

5.4 KB

 

Showing first 4 matched files of 1275 total files

[Udemy] 10 Days of No Code Artificial Intelligence Bootcamp (10.2021)

7.1 GB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/1. Introduction Day 9.mp4

36.0 MB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/1. Introduction Day 9.srt

2.1 KB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/10. Task 6. Delete Endpoint.mp4

11.0 MB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/10. Task 6. Delete Endpoint.srt

2.7 KB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/11. Task 7. Final Project Overview.mp4

26.0 MB

 

Showing first 5 matched files of 235 total files

PassageMaker - November-December 2024.pdf

78.6 MB

[OTUS] Промышленный Machine Learning на больших данных (2020)

8.9 GB

/31. Amazon Sagemaker/chat.txt

3.1 KB

/31. Amazon Sagemaker/dock_lect.pdf

1.8 MB

/31. Amazon Sagemaker/zoom_0.mp4

81.9 MB

 

Showing first 3 matched files of 113 total files

[Tutorialsplanet.NET] Udemy - 2019 AWS SageMaker and Machine Learning - With Python

1/0

4.9 GB

/10. 2019 SageMaker HyperParameter Tuning/1. Downloadable Resources.html

0.2 KB

/10. 2019 SageMaker HyperParameter Tuning/1.1 AWS SageMaker Hyperparameter Tuning.pdf.pdf

72.7 KB

/10. 2019 SageMaker HyperParameter Tuning/1.2 FM-Autotuning-Lab-Configuration.xlsx.xlsx

10.9 KB

/10. 2019 SageMaker HyperParameter Tuning/2. Introduction to Hyperparameter Tuning.mp4

44.4 MB

/10. 2019 SageMaker HyperParameter Tuning/3. Lab Tuning Movie Rating Factorization Machine Recommender System.mp4

161.5 MB

 

Showing first 5 matched files of 215 total files

[FreeCoursesOnline.Me] A Cloud Guru - AWS Certified Machine Learning - Specialty 2020

1/0

2.9 GB

/03 Streaming Data Collection/005 Analyze live video at scale in real time using Amazon Kinesis Video Streams and Amazon SageMaker.txt

0.1 KB

/04 Data Preparation/009 AWS reInvent 2018 Integrate Amazon SageMaker with Apache Spark.txt

0.0 KB

/04 Data Preparation/009 Using Apache Spark with Amazon SageMaker - AWS Online Tech Talks.txt

0.0 KB

/04 Data Preparation/010 AWS reInvent 2018 Integrate Amazon SageMaker with Apache Spark.txt

0.1 KB

/06 Modeling/004 SageMaker Modeling.mp4

51.2 MB

 

Showing first 5 matched files of 172 total files

[FreeCourseSite.com] Udemy - 2023 Become AWS SageMaker ML Engineer in 30 Days + ChatGPT

0/1

20.6 GB

/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/001 Day Welcome Message.mp4

6.5 MB

/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/001 Day Welcome Message_en.srt

1.6 KB

/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/002 AWS-Essentials-Starter-Pack-Part-3.zip

11.8 MB

/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/002 Please Download Today's Materials.html

0.2 KB

/05 - Day 3 AWS Essentials Starter Pack - Part 3 (Amazon SageMaker)/003 Intro to SageMaker.mp4

179.2 MB

 

Showing first 5 matched files of 969 total files


Copyright © 2025 FileMood.com