FileMood

Showing results 33 to 52 of about 147 for sagemaker

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/5. Machine Learning AWS Certified Big Data exam only!/10. Quiz Amazon Machine Learning and SageMaker.html

0.1 KB

/5. Machine Learning AWS Certified Big Data exam only!/5. SageMaker.mp4

52.9 MB

/5. Machine Learning AWS Certified Big Data exam only!/5. SageMaker.srt

14.0 KB

 

Showing first 3 matched files of 612 total files

[GigaCourse.Com] Udemy - 10 Days of No Code Artificial Intelligence Bootcamp

7.1 GB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/1. Introduction Day 9.mp4

36.0 MB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/1. Introduction Day 9.srt

2.1 KB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/10. Task 6. Delete Endpoint.mp4

11.0 MB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/10. Task 6. Delete Endpoint.srt

2.7 KB

/11. Day 9 Predict credit card default using AWS SageMaker Autopilot/11. Task 7. Final Project Overview.mp4

26.0 MB

 

Showing first 5 matched files of 239 total files

UD1

5.3 GB

/04 Domain 3 Processing/075 SageMaker.mp4

52.9 MB

 

Showing first 1 matched files of 138 total files

60 Assorted Magazines PDF April 14 2021 Pack 2

3.2 GB

/Covers/Passagemaker January 2021.jpg

1.2 MB

/Magazines/Passagemaker January 2021.pdf

64.1 MB

 

Showing first 2 matched files of 120 total files

40 Assorted Magazines PDF March 6 2021 Pack 3

2.7 GB

/Covers/PassageMaker March 2021.jpg

1.1 MB

/Magazines/PassageMaker March 2021.pdf

62.1 MB

 

Showing first 2 matched files of 80 total files

60 Assorted Magazines PDF February 25 2021 Pack 4

3.1 GB

/Covers/Passagemaker January 2021.jpg

1.2 MB

/Magazines/Passagemaker January 2021.pdf

64.1 MB

 

Showing first 2 matched files of 120 total files

50 Assorted Magazines - January 28 2021

3.3 GB

/Covers/PassageMaker – March 2021.jpg

117.3 KB

/PassageMaker – March 2021.pdf

62.1 MB

 

Showing first 2 matched files of 100 total files

60 Assorted Magazines PDF December 17 2020 Part 1

3.3 GB

/Covers/Passagemaker January 2021.jpg

197.8 KB

/Magazines/Passagemaker January 2021.pdf

64.1 MB

 

Showing first 2 matched files of 120 total files

[ DevCourseWeb.com ] Introduction to SageMaker.zip

392.2 MB

AWS, Azure, Google, and Cloud Security

513.8 MB

/AWS, Azure, Google, and Cloud Security/EPUB/machinelearningintheawscloud_addintelligencetoapplicationswithamazonsagemakerandamazonrekognition.epub

56.5 MB

/AWS, Azure, Google, and Cloud Security/PDF/Machine Learning in the AWS Cloud_ Add Intelligence to Applications with Amazon SageMaker and Amazon Rekognition.pdf

25.9 MB

 

Showing first 2 matched files of 28 total files

UD610

3.6 GB

/aws-certified-cloud-practitioner-new/17 Machine Learning/162 SageMaker Overview.mp4

15.8 MB

 

Showing first 1 matched files of 196 total files

OR72

3.4 GB

/088 - AWS SageMaker and Factorization Machines.mp4

8.8 MB

/089 - SageMaker in Action - Factorization Machines on one million ratings, in the cloud.mp4

51.0 MB

 

Showing first 2 matched files of 107 total files

[FreeTutorials.Eu] Udemy - building-recommender-systems-with-machine-learning-and-ai

4.8 GB

/10 Scaling it Up/089 AWS SageMaker and Factorization Machines-en.srt

8.6 KB

/10 Scaling it Up/089 AWS SageMaker and Factorization Machines.mp4

16.3 MB

/10 Scaling it Up/090 SageMaker in Action Factorization Machines on one million ratings in the cloud-en.srt

13.2 KB

/10 Scaling it Up/090 SageMaker in Action Factorization Machines on one million ratings in the cloud.mp4

71.7 MB

 

Showing first 4 matched files of 223 total files

OR26

18.9 GB

/66 - 8.1 Understand Big Data for Sagemaker.mp4

487.9 MB

/67 - 8.2 Learn Sagemaker and EMR Integration.mp4

75.6 MB

 

Showing first 2 matched files of 76 total files

ACG56

628.1 MB

/05 Machine Learning and the Cloud/003 Amazon Sagemaker.txt

0.0 KB

 

Showing first 1 matched files of 57 total files

ITPT6

16.8 GB

/4.41 - SageMaker Essentials.mp4

471.3 MB

/4.51 - Training with SageMaker Notebooks.mp4

372.3 MB

 

Showing first 2 matched files of 37 total files

UD608

5.4 GB

/11 Appendix Machine Learning topics for the legacy AWS Certified Big Data exam/132 SageMaker.mp4

52.9 MB

 

Showing first 1 matched files of 141 total files

UD1

5.3 GB

/04 Domain 3 Processing/075 SageMaker.mp4

52.9 MB

 

Showing first 1 matched files of 137 total files

UD440

9.4 GB

/07 FEATURE ENGINEERING/066 Amazon SageMaker GroundTruth.mp4

88.5 MB

/10 MACHINE AND DEEP LEARNING IN AWS - PART 1/113 AWS SageMaker.mp4

92.6 MB

/10 MACHINE AND DEEP LEARNING IN AWS - PART 1/114 AWS SageMaker Part 2.mp4

137.1 MB

/10 MACHINE AND DEEP LEARNING IN AWS - PART 1/116 SageMaker Built-in algorithms overview.mp4

74.7 MB

/11 MACHINE AND DEEP LEARNING IN AWS - PART 2/129 SageMaker Built-in Algorithms Overview.mp4

48.0 MB

 

Showing first 5 matched files of 185 total files

LA667

3.2 GB

/44. SageMaker Modeling.mp4

51.3 MB

/45. SageMaker Training.mp4

41.1 MB

/72. Amazon SageMaker Deployments.mp4

38.1 MB

 

Showing first 3 matched files of 79 total files


Copyright © 2025 FileMood.com