FileMood

Showing results 0 to 19 of about 923 for whitepaper

Amazon Web Services (AWS), 3rd Edition

0/1

4.0 GB

/Module 14 Course Wrap-Up and Next Steps/Lesson 34 Well-Architected Framework/003. 34.2 Whitepapers en.srt

3.3 KB

/Module 14 Course Wrap-Up and Next Steps/Lesson 34 Well-Architected Framework/003. 34.2 Whitepapers.mp4

10.0 MB

 

Showing first 2 matched files of 494 total files

O`REILLY - AWS Account Setup Best Practices

4.4 GB

/35.7.3 Whitepapers.mp4

102.8 MB

 

Showing first 1 matched files of 40 total files

AWS Essentials

3/0

3.5 GB

/[TutsNode.net] - AWS Essentials/02 The Power of an AWS Account/004 AWS Whitepapers.txt

0.0 KB

 

Showing first 1 matched files of 186 total files

Docker

0/1

38.4 GB

/docker-mastery/25 - DevOps and Docker Clips/008 HPE-and-Docker-Whitepaper-on-MySQL-performance.url

0.1 KB

 

Showing first 1 matched files of 931 total files

[GigaCourse.Com] Udemy - AWS Certified Advanced Networking - Specialty 2024

7/4

11.9 GB

/06 - Virtual Private Networks, IPSec Tunnels and Transit Gateways/064 Important Reference Documents & WhitePapers.html

0.5 KB

 

Showing first 1 matched files of 571 total files

[ DevCourseWeb.com ] Udemy - Complete VMware vSphere 7 with Windows Server 2019

2.7 GB

/~Get Your Files Here !/5. VMware vSphere 7/1.1 vmware-vsphere-pricing-whitepaper-sep2020.pdf

461.6 KB

 

Showing first 1 matched files of 42 total files

GetFreeCourses.Co-Udemy-Docker Mastery with Kubernetes +Swarm from a Docker Captain

4/1

14.4 GB

/25 - DevOps and Docker Clips/008 HPE-and-Docker-Whitepaper-on-MySQL-performance.url

0.1 KB

 

Showing first 1 matched files of 675 total files

Getting Started with Web3 Development

7.4 GB

/Getting Started with Web3 Development/03 - What is a blockchain (and what it's not)/001 The-Bitcoin-whitepaper.url

0.1 KB

/Getting Started with Web3 Development/03 - What is a blockchain (and what it's not)/005 The-Bitcoin-whitepaper.url

0.1 KB

/Getting Started with Web3 Development/03 - What is a blockchain (and what it's not)/005 The-Ethereum-whitepaper.url

0.1 KB

 

Showing first 3 matched files of 439 total files

[ FreeCourseWeb.com ] Udemy - Open Banking, PSD2 and GDPR. FinTech

1/4

981.9 MB

/~Get Your Files Here !/5. Payment Services Directive (PSD) 2/PSD2-Whitepaper.pdf

215.3 KB

 

Showing first 1 matched files of 31 total files

[FreeCourseSite.com] Udemy - AWS Certified Cloud Practitioner Exam Training [New] 2023

9/1

6.9 GB

/14 - Architecting for the Cloud/004 https-d1.awsstatic.com-whitepapers-aws-caf-ebook.pdf.url

0.1 KB

 

Showing first 1 matched files of 436 total files

[FreeCourseSite.com] Udemy - Docker Mastery with Kubernetes +Swarm from a Docker Captain

13/0

14.4 GB

/25 - DevOps and Docker Clips/008 HPE-and-Docker-Whitepaper-on-MySQL-performance.url

0.1 KB

 

Showing first 1 matched files of 683 total files

[ FreeCryptoLearn.com ] Udemy - Introduction to Cryptocurrency and Blockchain Technology

1/2

3.3 GB

/~Get Your Files Here !/3.1 Bitcoin Whitepaper.pdf

184.3 KB

 

Showing first 1 matched files of 24 total files

[GigaCourse.Com] Udemy - Docker Mastery with Kubernetes Swarm from a Docker Captain

1/2

19.2 GB

/21 - DevOps and Docker Clips/159 - HPE and Docker Whitepaper on MySQL performance.txt

0.0 KB

 

Showing first 1 matched files of 2600 total files

desirecourse.netudemyawscertifieddataanalyticsspecialty2020exbigdata

6.7 GB

/10. Preparing for the Exam/1.2 Kinesis Whitepaper.html

0.1 KB

/10. Preparing for the Exam/1.3 AWS Database Migration Service Whitepaper.html

0.2 KB

/10. Preparing for the Exam/1.5 Big Data Whitepaper.html

0.1 KB

 

Showing first 3 matched files of 612 total files

[GigaCourse.Com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

10.3 GB

/03 - SDLC Automation (Domain 1)/044 WhitePapers to Read - AWS Certified DevOps Engineer Professional.html

1.8 KB

 

Showing first 1 matched files of 242 total files

[ FreeCryptoLearn.com ] Udemy - Ultimate Crypto Course to Create Your Own Crypto Coin

1/0

1.4 GB

/~Get Your Files Here !/3. Project Website Essentials/6. Whitepaper.mp4

59.3 MB

/~Get Your Files Here !/3. Project Website Essentials/6. Whitepaper.srt

6.7 KB

 

Showing first 2 matched files of 44 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2022 - Hands On!

2/0

10.3 GB

/03 - SDLC Automation (Domain 1)/044 WhitePapers to Read - AWS Certified DevOps Engineer Professional.html

1.8 KB

 

Showing first 1 matched files of 234 total files

[FreeCoursesOnline.Me] A Cloud Guru - AWS Essentials

8/0

3.5 GB

/02 The Power of an AWS Account/004 AWS Whitepapers.txt

0.0 KB

 

Showing first 1 matched files of 130 total files

[FreeCourseSite.com] Udemy - Docker Mastery with Kubernetes +Swarm from a Docker Captain

6/0

22.4 GB

/23 - DevOps and Docker Clips/008 HPE-and-Docker-Whitepaper-on-MySQL-performance.url

0.1 KB

 

Showing first 1 matched files of 711 total files

[FreeCourseSite.com] Udemy - AWS Certified DevOps Engineer Professional 2023 - DOP-C02

11/2

10.5 GB

/10 - [OLD] [DOP-C01] SDLC Automation (Domain 1)/044 WhitePapers to Read - AWS Certified DevOps Engineer Professional.html

1.8 KB

 

Showing first 1 matched files of 918 total files


Copyright © 2024 FileMood.com